PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_011160-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB
Protein Properties Length: 425aa    MW: 45438.9 Da    PI: 6.3194
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_011160-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding538.1e-1756101147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +g+W++eEd +l ++v ++G ++W++Iar +  gR++k+c++rw + 
    NNU_011160-RA  56 KGPWSPEEDAILSRLVSKFGARNWSLIARGIA-GRSGKSCRLRWCNQ 101
                      79******************************.***********985 PP

2Myb_DNA-binding56.75.5e-18108152147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      r+++T eEd ++v a++ +G++ W++Iar ++ gRt++ +k++w++ 
    NNU_011160-RA 108 RKPFTDEEDRIIVAAHAIHGNK-WASIARLLQ-GRTDNAIKNHWNST 152
                      789*******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129420.77851102IPR017930Myb domain
SuperFamilySSF466899.35E-3053149IPR009057Homeodomain-like
SMARTSM007173.2E-1555104IPR001005SANT/Myb domain
PfamPF002494.7E-1656101IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-2557109IPR009057Homeodomain-like
CDDcd001672.20E-1458100No hitNo description
PROSITE profilePS5129426.434103157IPR017930Myb domain
SMARTSM007171.7E-16107155IPR001005SANT/Myb domain
PfamPF002495.4E-15108152IPR001005SANT/Myb domain
CDDcd001672.49E-12110153No hitNo description
Gene3DG3DSA:1.10.10.601.2E-22110156IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 425 aa     Download sequence    Send to blast
MKKEEAIVAG DGGCGGDGSA SGTGGDGADS GSGVGVVGEG NCSSSRVRSG SEDRVKGPWS  60
PEEDAILSRL VSKFGARNWS LIARGIAGRS GKSCRLRWCN QLDPCVKRKP FTDEEDRIIV  120
AAHAIHGNKW ASIARLLQGR TDNAIKNHWN STLRRRCMEL DRFRSASGDM VEEASLDKTK  180
ASSEETLSCG DVNSFKSLDG KDVNSLENIS NQYEDKAQIK EDHGSAEAKD PPTLFRPVAR  240
VSAFSLYNPV DGPTIRSSSG AVPLHGPLVQ PSKPDFGICK LLEGDVCGDP LVPPRCGYCC  300
CGTQNGAQSG GNSQSSLLGP EFVDFVEPPP FSSHELASIA TDLSNIAWLK SGLENGRTKI  360
LDNAAGGMIS QAAQMQMGHV EENRKNDHLR FEEGRNKLMG MMTEVLSSQM ARQPFGVPAK  420
VEGLI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-40501561107B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010262707.10.0PREDICTED: uncharacterized protein LOC104601164
TrEMBLD7THE00.0D7THE0_VITVI; Putative uncharacterized protein
STRINGVIT_08s0007g01540.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G55730.11e-88myb domain protein 109